MAPKAPK2 monoclonal antibody (M01), clone 2B3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
MAPKAPK2 monoclonal antibody (M01), clone 2B3 Western Blot analysis of MAPKAPK2 expression in K-562 ( Cat # L009V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MAPKAPK2 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]
Immunoprecipitation
Immunoprecipitation of MAPKAPK2 transfected lysate using anti-MAPKAPK2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with MAPKAPK2 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MAPKAPK2 is approximately 0.1ng/ml as a capture antibody.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between AKT1 and MAPKAPK2. HeLa cells were stained with anti-AKT1 rabbit purified polyclonal 1:1200 and anti-MAPKAPK2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Immunofluorescence
Immunofluorescence of monoclonal antibody to MAPKAPK2 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MAPKAPK2.
Immunogen
MAPKAPK2 (NP_116584, 302 a.a. ~ 400 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
IRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (92)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
MAPKAPK2 monoclonal antibody (M01), clone 2B3 Western Blot analysis of MAPKAPK2 expression in K-562 ( Cat # L009V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MAPKAPK2 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of MAPKAPK2 transfected lysate using anti-MAPKAPK2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with MAPKAPK2 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MAPKAPK2 is approximately 0.1ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between AKT1 and MAPKAPK2. HeLa cells were stained with anti-AKT1 rabbit purified polyclonal 1:1200 and anti-MAPKAPK2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).Immunofluorescence
Immunofluorescence of monoclonal antibody to MAPKAPK2 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — MAPKAPK2
Entrez GeneID
9261GeneBank Accession#
NM_032960Protein Accession#
NP_116584Gene Name
MAPKAPK2
Gene Alias
MK2
Gene Description
mitogen-activated protein kinase-activated protein kinase 2
Omim ID
602006Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the Ser/Thr protein kinase family. This kinase is regulated through direct phosphorylation by p38 MAP kinase. In conjunction with p38 MAP kinase, this kinase is known to be involved in many cellular processes including stress and inflammatory responses, nuclear export, gene expression regulation and cell proliferation. Heat shock protein HSP27 was shown to be one of the substrates of this kinase in vivo. Two transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000034531|OTTHUMP00000034532
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com