Product Browser

Last updated: 2017/3/26
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MAP3K6 polyclonal antibody (A01)

  • Catalog # : H00009064-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant MAP3K6.
  • Immunogen:
  • MAP3K6 (AAH15914, 225 a.a. ~ 325 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • HFWLHFLLQSCQPFKTACAQGDQCLVLVLEMNKVLLPAKLEVRGTDPVSTVTLSLLEPETQDIPSSWTFPVASICGVSASKRDERCCFLYALPPAQDVQLC
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009064-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9064
  • Gene Name:
  • MAP3K6
  • Gene Alias:
  • ASK2,MAPKKK6,MGC125653,MGC20114
  • Gene Description:
  • mitogen-activated protein kinase kinase kinase 6
  • Gene Summary:
  • This gene encodes a member of the serine/threonine protein kinase family. The encoded kinase was identified by its interaction with MAP3K5/ASK, a protein kinase and an activator of c-Jun kinase (MAPK7/JNK) and MAPK14/p38 kinase. This kinase was found to weakly activate MAPK7, but not MAPK1/ERK or MAPK14. An alternatively spliced transcript variant has been found for this gene, but its biological validity has not been determined. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000005063,apoptosis signal-regulating kinase 2
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook