Product Browser

Last updated: 2017/5/28

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFRSF11A (Human) Recombinant ProteinHuPro Protein

  • Catalog # : H00008792-H02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Purified TNFRSF11A (NP_003830.1 30 a.a. - 212 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
  • Transfected Cell Line:
  • Human HEK293H cells
  • Sequence:
  • IAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHVYLP
  • Host:
  • Human
  • Theoretical MW (kDa):
  • 25.41
  • Form:
  • Liquid
  • Preparation Method:
  • Transfection of pSuper-TNFRSF11A plasmid into HEK293H cell, and the expressed protein was purified by Strep-Tactin affinity column.
  • Purification:
  • Strep-Tactin affinity columns
  • Concentration:
  • ≥ 10 ug/ml
  • Activity:
  • Not Tested
  • Storage Buffer:
  • 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Application Image
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Gene Information
  • Entrez GeneID:
  • 8792
  • Gene Name:
  • TNFRSF11A
  • Gene Alias:
  • CD265,FEO,LOH18CR1,ODFR,OFE,OPTB7,OSTS,PDB2,RANK,TRANCER
  • Gene Description:
  • tumor necrosis factor receptor superfamily, member 11a, NFKB activator
  • Gene Summary:
  • The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptors can interact with various TRAF family proteins, through which this receptor induces the activation of NF-kappa B and MAPK8/JNK. This receptor and its ligand are important regulators of the interaction between T cells and dendritic cells. This receptor is also an essential mediator for osteoclast and lymph node development. Studies of the mouse counterpart suggest that this receptor directly mediates the osteoprotegerin ligand (OPGL)-induced osteoclastogenesis in osteoclast precursor cells. [provided by RefSeq
  • Other Designations:
  • loss of heterozygosity, 18, chromosomal region 1,osteoclast differentiation factor receptor,receptor activator of nuclear factor-kappa B,tumor necrosis factor receptor superfamily, member 11a,tumor necrosis factor receptor superfamily, member 11a, activat
  • RSS
  • YouTube
  • Linkedin
  • Facebook