Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HSD17B6 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00008630-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human HSD17B6 protein.
  • Immunogen:
  • HSD17B6 (NP_003716.2, 1 a.a. ~ 317 a.a) full-length human protein.
  • Sequence:
  • MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLDARGLRVLAACLTEKGAEQLRGQTSDRLETVTLDVTKMESIAAATQWVKEHVGDRGLWGLVNNAGILTPITLCEWLNTEDSMNMLKVNLIGVIQVTLSMLPLVRRARGRIVNVSSILGRVAFFVGGYCVSKYGVEAFSDILRREIQHFGVKISIVEPGYFRTGMTNMTQSLERMKQSWKEAPKHIKETYGQQYFDALYNIMKEGLLNCSTNLNLVTDCMEHALTSVHPRTRYSAGWDAKFFFIPLSYLPTSLADYILTRSWPKPAQAV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • HSD17B6 MaxPab polyclonal antibody. Western Blot analysis of HSD17B6 expression in human liver.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of HSD17B6 expression in transfected 293T cell line (H00008630-T01) by HSD17B6 MaxPab polyclonal antibody.

    Lane 1: HSD17B6 transfected lysate(34.87 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 8630
  • Gene Name:
  • HSD17B6
  • Gene Alias:
  • HSE,RODH,SDR9C6
  • Gene Description:
  • hydroxysteroid (17-beta) dehydrogenase 6 homolog (mouse)
  • Gene Summary:
  • The protein encoded by this gene has both oxidoreductase and epimerase activities and is involved in androgen catabolism. The oxidoreductase activity can convert 3 alpha-adiol to dihydrotestosterone, while the epimerase activity can convert androsterone to epi-androsterone. Both reactions use NAD+ as the preferred cofactor. This gene is a member of the retinol dehydrogenase family. Transcript variants utilizing alternative polyadenylation signals exist. [provided by RefSeq
  • Other Designations:
  • 3(alpha->beta)-hydroxysteroid epimerase,3(alpha->beta)-hydroxysteroid epimerasel,3-hydroxysteroid epimerase,NAD+ -dependent 3 alpha-hydroxysteroid dehydrogenase 3-hydroxysteroid epimerase,hydroxysteroid (17-beta) dehydrogenase 6,oxidative 3-alpha-hydroxys
  • RSS
  • YouTube
  • Linkedin
  • Facebook