COPS3 monoclonal antibody (M02), clone 2D10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
COPS3 monoclonal antibody (M02), clone 2D10. Western Blot analysis of COPS3 expression in PC-12 ( Cat # L012V1 ).
Western Blot (Cell lysate)
COPS3 monoclonal antibody (M02), clone 2D10 Western Blot analysis of COPS3 expression in HeLa ( Cat # L013V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of COPS3 expression in transfected 293T cell line by COPS3 monoclonal antibody (M02), clone 2D10.
Lane 1: COPS3 transfected lysate(47.9 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged COPS3 is approximately 0.1ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to COPS3 on HeLa cell. [antibody concentration 20 ug/ml]
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant COPS3.
Immunogen
COPS3 (NP_003644, 324 a.a. ~ 422 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SRVQLSGPQEAEKYVLHMIEDGEIFASINQKDGMVSFHDNPEKYNNPAMLHNIDQEMLKCIELDERLKAMDQEITVNPQFVQKSMGSQEDDSGNKPSSY
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
COPS3 monoclonal antibody (M02), clone 2D10. Western Blot analysis of COPS3 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
COPS3 monoclonal antibody (M02), clone 2D10 Western Blot analysis of COPS3 expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of COPS3 expression in transfected 293T cell line by COPS3 monoclonal antibody (M02), clone 2D10.
Lane 1: COPS3 transfected lysate(47.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged COPS3 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to COPS3 on HeLa cell. [antibody concentration 20 ug/ml] -
Gene Info — COPS3
Entrez GeneID
8533GeneBank Accession#
NM_003653Protein Accession#
NP_003644Gene Name
COPS3
Gene Alias
CSN3, SGN3
Gene Description
COP9 constitutive photomorphogenic homolog subunit 3 (Arabidopsis)
Omim ID
604665Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene possesses kinase activity that phosphorylates regulators involved in signal transduction. It phosphorylates I kappa-Balpha, p105, and c-Jun. It acts as a docking site for complex-mediated phosphorylation. The gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq
Other Designations
COP9 complex subunit 3|COP9 constitutive photomorphogenic homolog subunit 3|JAB1-containing signalosome subunit 3
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com