COPS3 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
COPS3 polyclonal antibody (A01), Lot # 060113JC01. Western Blot analysis of COPS3 expression in PC-12.
Western Blot (Cell lysate)
COPS3 polyclonal antibody (A01), Lot # 060113JC01. Western Blot analysis of COPS3 expression in NIH/3T3.
Western Blot (Cell lysate)
COPS3 polyclonal antibody (A01), Lot # 060113JC01. Western Blot analysis of COPS3 expression in Raw 264.7.
Western Blot (Cell lysate)
COPS3 polyclonal antibody (A01), Lot # 060113JC01 Western Blot analysis of COPS3 expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot detection against Immunogen (37 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant COPS3.
Immunogen
COPS3 (NP_003644, 324 a.a. ~ 422 a.a) partial recombinant protein with GST tag.
Sequence
SRVQLSGPQEAEKYVLHMIEDGEIFASINQKDGMVSFHDNPEKYNNPAMLHNIDQEMLKCIELDERLKAMDQEITVNPQFVQKSMGSQEDDSGNKPSSY
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
COPS3 polyclonal antibody (A01), Lot # 060113JC01. Western Blot analysis of COPS3 expression in PC-12.Western Blot (Cell lysate)
COPS3 polyclonal antibody (A01), Lot # 060113JC01. Western Blot analysis of COPS3 expression in NIH/3T3.Western Blot (Cell lysate)
COPS3 polyclonal antibody (A01), Lot # 060113JC01. Western Blot analysis of COPS3 expression in Raw 264.7.Western Blot (Cell lysate)
COPS3 polyclonal antibody (A01), Lot # 060113JC01 Western Blot analysis of COPS3 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — COPS3
Entrez GeneID
8533GeneBank Accession#
NM_003653Protein Accession#
NP_003644Gene Name
COPS3
Gene Alias
CSN3, SGN3
Gene Description
COP9 constitutive photomorphogenic homolog subunit 3 (Arabidopsis)
Omim ID
604665Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene possesses kinase activity that phosphorylates regulators involved in signal transduction. It phosphorylates I kappa-Balpha, p105, and c-Jun. It acts as a docking site for complex-mediated phosphorylation. The gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq
Other Designations
COP9 complex subunit 3|COP9 constitutive photomorphogenic homolog subunit 3|JAB1-containing signalosome subunit 3
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com