Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TRPV1 polyclonal antibody (A01)

  • Catalog # : H00007442-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant TRPV1.
  • Immunogen:
  • TRPV1 (NP_542437, 21 a.a. ~ 124 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • CPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007442-A01
    Western Blot detection against Immunogen (37.55 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7442
  • Gene Name:
  • TRPV1
  • Gene Alias:
  • DKFZp434K0220,VR1
  • Gene Description:
  • transient receptor potential cation channel, subfamily V, member 1
  • Gene Summary:
  • Capsaicin, the main pungent ingredient in hot chili peppers, elicits a sensation of burning pain by selectively activating sensory neurons that convey information about noxious stimuli to the central nervous system. The protein encoded by this gene is a receptor for capsaicin and is a non-selective cation channel that is structurally related to members of the TRP family of ion channels. This receptor is also activated by increases in temperature in the noxious range, suggesting that it functions as a transducer of painful thermal stimuli in vivo. Four transcript variants encoding the same protein, but with different 5' UTR sequence, have been described for this gene. [provided by RefSeq
  • Other Designations:
  • capsaicin receptor,transient receptor potential vanilloid 1a,transient receptor potential vanilloid 1b,vanilloid receptor subtype 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook