TNNT1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human TNNT1 protein.
Immunogen
TNNT1 (NP_003274, 1 a.a. ~ 251 a.a) full-length human protein.
Sequence
MSDTEEQEYEEEQPEEEAAEEEEEEEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKRMEKDLLELQTLIDVHFEQRKKEEEELVALKERIERRRSERAEQQRFRTEKERERQAKLAEEKMRKEEEEAKKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKVRILSERKKPLDIDYMGEEQLREKAQELSDWIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TNNT1 MaxPab polyclonal antibody. Western Blot analysis of TNNT1 expression in SJCRH30.Western Blot (Transfected lysate)
Western Blot analysis of TNNT1 expression in transfected 293T cell line (H00007138-T01) by TNNT1 MaxPab polyclonal antibody.
Lane 1: TNNT1 transfected lysate(27.61 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — TNNT1
Entrez GeneID
7138GeneBank Accession#
NM_003283Protein Accession#
NP_003274Gene Name
TNNT1
Gene Alias
ANM, FLJ98147, MGC104241, STNT, TNT, TNTS
Gene Description
troponin T type 1 (skeletal, slow)
Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that is a subunit of troponin, which is a regulatory complex located on the thin filament of the sarcomere. This complex regulates striated muscle contraction in response to fluctuations in intracellular calcium concentration. This complex is composed of three subunits: troponin C, which binds calcium, troponin T, which binds tropomyosin, and troponin I, which is an inhibitory subunit. This protein is the slow skeletal troponin T subunit. Mutations in this gene cause nemaline myopathy type 5, also known as Amish nemaline myopathy, a neuromuscular disorder characterized by muscle weakness and rod-shaped, or nemaline, inclusions in skeletal muscle fibers which affects infants, resulting in death due to respiratory insufficiency, usually in the second year. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
slow skeletal muscle troponin T|troponin T1, skeletal, slow|troponin-T1, skeletal, slow
-
Interactome
-
Disease
-
Publication Reference
-
Novel target genes responsive to the anti-growth activity of triptolide in endometrial and ovarian cancer cells.
Li H, Takai N, Yuge A, Furukawa Y, Tsuno A, Tsukamoto Y, Kong S, Moriyama M, Narahara H.
Cancer Letters 2010 Nov; 297(2):198.
Application:WB-Ce, Human, HHUA, Ishikawa, HEC-1B, SK-OV-3, OVCAR-3 (cells).
-
Novel target genes responsive to the anti-growth activity of triptolide in endometrial and ovarian cancer cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com