MAP2K3 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of MAP2K3 expression in transfected 293T cell line (H00005606-T01) by MAP2K3 MaxPab polyclonal antibody.
Lane 1: MAP2K3 transfected lysate(39.30 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between MAP2K3 and MAP3K4. HeLa cells were stained with anti-MAP2K3 rabbit purified polyclonal 1:1200 and anti-MAP3K4 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human MAP2K3 protein.
Immunogen
MAP2K3 (NP_659731.1, 1 a.a. ~ 347 a.a) full-length human protein.
Sequence
MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of MAP2K3 expression in transfected 293T cell line (H00005606-T01) by MAP2K3 MaxPab polyclonal antibody.
Lane 1: MAP2K3 transfected lysate(39.30 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between MAP2K3 and MAP3K4. HeLa cells were stained with anti-MAP2K3 rabbit purified polyclonal 1:1200 and anti-MAP3K4 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — MAP2K3
Entrez GeneID
5606GeneBank Accession#
NM_145109.1Protein Accession#
NP_659731.1Gene Name
MAP2K3
Gene Alias
MAPKK3, MEK3, MKK3, PRKMK3
Gene Description
mitogen-activated protein kinase kinase 3
Omim ID
602315Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is activated by mitogenic and environmental stress, and participates in the MAP kinase-mediated signaling cascade. It phosphorylates and thus activates MAPK14/p38-MAPK. This kinase can be activated by insulin, and is necessary for the expression of glucose transporter. Expression of RAS oncogene is found to result in the accumulation of the active form of this kinase, which thus leads to the constitutive activation of MAPK14, and confers oncogenic transformation of primary cells. The inhibition of this kinase is involved in the pathogenesis of Yersina pseudotuberculosis. Multiple alternatively spliced transcript variants that encode distinct isoforms have been reported for this gene. [provided by RefSeq
Other Designations
MAP kinase kinase 3|MAPK/ERK kinase 3|OTTHUMP00000166044|dual specificity mitogen activated protein kinase kinase 3
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com