PRKAA2 monoclonal antibody (M02), clone 1G8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PRKAA2.
Immunogen
PRKAA2 (NP_006243, 453 a.a. ~ 552 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSLQLYLVDNRSYLLDFKSIDDEVVEQRSGSSTPQRSCSAAGLHRPRSSFDSTTAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFFEMCASLITTLAR
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PRKAA2 expression in transfected 293T cell line by PRKAA2 monoclonal antibody (M02), clone 1G8.
Lane 1: PRKAA2 transfected lysate(62.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PRKAA2 is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of PRKAA2 over-expressed 293 cell line, cotransfected with PRKAA2 Validated Chimera RNAi ( Cat # H00005563-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PRKAA2 monoclonal antibody (M02) clone 1G8 (Cat # H00005563-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between STK11 and PRKAA2. HeLa cells were stained with anti-STK11 rabbit purified polyclonal 1:1200 and anti-PRKAA2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).Immunofluorescence
Immunofluorescence of monoclonal antibody to PRKAA2 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — PRKAA2
Entrez GeneID
5563GeneBank Accession#
NM_006252Protein Accession#
NP_006243Gene Name
PRKAA2
Gene Alias
AMPK, AMPK2, PRKAA
Gene Description
protein kinase, AMP-activated, alpha 2 catalytic subunit
Omim ID
600497Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a catalytic subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. Studies of the mouse counterpart suggest that this catalytic subunit may control whole-body insulin sensitivity and is necessary for maintaining myocardial energy homeostasis during ischemia. [provided by RefSeq
Other Designations
5'-AMP-activated protein kinase, catalytic alpha-2 chain|AMP-activated protein kinase alpha 2 catalytic subunit|AMPK-alpha-2 chain|OTTHUMP00000009993
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com