PPP2R4 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
PPP2R4 MaxPab rabbit polyclonal antibody. Western Blot analysis of PPP2R4 expression in mouse kidney.
Western Blot (Cell lysate)
PPP2R4 MaxPab rabbit polyclonal antibody. Western Blot analysis of PPP2R4 expression in Hela S3 NE.
Western Blot (Transfected lysate)
Western Blot analysis of PPP2R4 expression in transfected 293T cell line (H00005524-T01) by PPP2R4 MaxPab polyclonal antibody.
Lane 1: PPP2R4 transfected lysate(36.80 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to PPP2R4 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human PPP2R4 protein.
Immunogen
PPP2R4 (NP_066954.2, 1 a.a. ~ 323 a.a) full-length human protein.
Sequence
MAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTSG
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PPP2R4 MaxPab rabbit polyclonal antibody. Western Blot analysis of PPP2R4 expression in mouse kidney.Western Blot (Cell lysate)
PPP2R4 MaxPab rabbit polyclonal antibody. Western Blot analysis of PPP2R4 expression in Hela S3 NE.Western Blot (Transfected lysate)
Western Blot analysis of PPP2R4 expression in transfected 293T cell line (H00005524-T01) by PPP2R4 MaxPab polyclonal antibody.
Lane 1: PPP2R4 transfected lysate(36.80 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to PPP2R4 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — PPP2R4
Entrez GeneID
5524GeneBank Accession#
NM_021131.3Protein Accession#
NP_066954.2Gene Name
PPP2R4
Gene Alias
MGC2184, PP2A, PR53, PTPA
Gene Description
protein phosphatase 2A activator, regulatory subunit 4
Omim ID
600756Gene Ontology
HyperlinkGene Summary
Protein phosphatase 2A is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2A holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B''/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B' family. This gene encodes a specific phosphotyrosyl phosphatase activator of the dimeric form of protein phosphatase 2A. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
OTTHUMP00000022333|PP2A phosphatase activator|PP2A, subunit B'|phosphotyrosyl phosphatase activator|protein phosphatase 2A, regulatory subunit B'|protein phosphatase 2A, regulatory subunit B' (PR 53)
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com