PPP2R4 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant PPP2R4.
Immunogen
PPP2R4 (NP_066954, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag.
Sequence
QNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLV
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PPP2R4 polyclonal antibody (A01), Lot # 051212JC01 Western Blot analysis of PPP2R4 expression in HL-60 ( Cat # L014V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — PPP2R4
Entrez GeneID
5524GeneBank Accession#
NM_021131Protein Accession#
NP_066954Gene Name
PPP2R4
Gene Alias
MGC2184, PP2A, PR53, PTPA
Gene Description
protein phosphatase 2A activator, regulatory subunit 4
Omim ID
600756Gene Ontology
HyperlinkGene Summary
Protein phosphatase 2A is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2A holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B''/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B' family. This gene encodes a specific phosphotyrosyl phosphatase activator of the dimeric form of protein phosphatase 2A. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
OTTHUMP00000022333|PP2A phosphatase activator|PP2A, subunit B'|phosphotyrosyl phosphatase activator|protein phosphatase 2A, regulatory subunit B'|protein phosphatase 2A, regulatory subunit B' (PR 53)
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com