PPP2R4 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of PPP2R4 expression in transfected 293T cell line (H00005524-T01) by PPP2R4 MaxPab polyclonal antibody.
Lane 1: PPP2R4 transfected lysate(35.53 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to PPP2R4 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human PPP2R4 protein.
Immunogen
PPP2R4 (NP_066954.2, 1 a.a. ~ 323 a.a) full-length human protein.
Sequence
MAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTSG
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PPP2R4 expression in transfected 293T cell line (H00005524-T01) by PPP2R4 MaxPab polyclonal antibody.
Lane 1: PPP2R4 transfected lysate(35.53 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to PPP2R4 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — PPP2R4
Entrez GeneID
5524GeneBank Accession#
NM_021131.3Protein Accession#
NP_066954.2Gene Name
PPP2R4
Gene Alias
MGC2184, PP2A, PR53, PTPA
Gene Description
protein phosphatase 2A activator, regulatory subunit 4
Omim ID
600756Gene Ontology
HyperlinkGene Summary
Protein phosphatase 2A is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2A holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B''/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B' family. This gene encodes a specific phosphotyrosyl phosphatase activator of the dimeric form of protein phosphatase 2A. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
OTTHUMP00000022333|PP2A phosphatase activator|PP2A, subunit B'|phosphotyrosyl phosphatase activator|protein phosphatase 2A, regulatory subunit B'|protein phosphatase 2A, regulatory subunit B' (PR 53)
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com