PI3 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of PI3 expression in transfected 293T cell line (H00005266-T01) by PI3 MaxPab polyclonal antibody.
Lane 1: PI3 transfected lysate(12.87 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human PI3 protein.
Immunogen
PI3 (NP_002629.1, 1 a.a. ~ 117 a.a) full-length human protein.
Sequence
MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PI3 expression in transfected 293T cell line (H00005266-T01) by PI3 MaxPab polyclonal antibody.
Lane 1: PI3 transfected lysate(12.87 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — PI3
Entrez GeneID
5266GeneBank Accession#
NM_002638.2Protein Accession#
NP_002629.1Gene Name
PI3
Gene Alias
ESI, MGC13613, SKALP, WAP3, WFDC14, cementoin
Gene Description
peptidase inhibitor 3, skin-derived
Omim ID
182257Gene Ontology
HyperlinkGene Summary
This gene encodes an elastase-specific inhibitor that functions as an antimicrobial peptide against Gram-positive and Gram-negative bacteria. The protein contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. Expression of this gene is upgulated by bacterial lipopolysaccharides and cytokines. [provided by RefSeq
Other Designations
OTTHUMP00000031100|WAP four-disulfide core domain 14|elafin|elastase-specific inhibitor|protease inhibitor 3, skin-derived (SKALP)|skin-derived antileukoproteinase
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com