Product Browser

Last updated: 2017/9/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PI3 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00005266-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human PI3 protein.
  • Immunogen:
  • PI3 (NP_002629.1, 1 a.a. ~ 117 a.a) full-length human protein.
  • Sequence:
  • MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of PI3 expression in transfected 293T cell line (H00005266-T01) by PI3 MaxPab polyclonal antibody.

    Lane 1: PI3 transfected lysate(12.87 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 5266
  • Gene Name:
  • PI3
  • Gene Alias:
  • ESI,MGC13613,SKALP,WAP3,WFDC14,cementoin
  • Gene Description:
  • peptidase inhibitor 3, skin-derived
  • Gene Summary:
  • This gene encodes an elastase-specific inhibitor that functions as an antimicrobial peptide against Gram-positive and Gram-negative bacteria. The protein contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. Expression of this gene is upgulated by bacterial lipopolysaccharides and cytokines. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000031100,WAP four-disulfide core domain 14,elafin,elastase-specific inhibitor,protease inhibitor 3, skin-derived (SKALP),skin-derived antileukoproteinase
  • RSS
  • YouTube
  • Linkedin
  • Facebook