MYL5 monoclonal antibody (M01), clone 1C5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of MYL5 expression in transfected 293T cell line by MYL5 monoclonal antibody (M01), clone 1C5.
Lane 1: MYL5 transfected lysate(19.5 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MYL5 is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (40.26 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant MYL5.
Immunogen
MYL5 (AAH40050.1, 1 a.a. ~ 132 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MDQNRDGFIDKEDLKDTYASLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKINKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVITHGEEKEE
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (40.26 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of MYL5 expression in transfected 293T cell line by MYL5 monoclonal antibody (M01), clone 1C5.
Lane 1: MYL5 transfected lysate(19.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MYL5 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — MYL5
Entrez GeneID
4636GeneBank Accession#
BC040050Protein Accession#
AAH40050.1Gene Name
MYL5
Gene Alias
-
Gene Description
myosin, light chain 5, regulatory
Omim ID
160782Gene Ontology
HyperlinkGene Summary
This gene encodes one of the myosin light chains, a component of the hexameric ATPase cellular motor protein myosin. Myosin is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene product, one of the regulatory light chains, is expressed in fetal muscle and in adult retina, cerebellum, and basal ganglia. [provided by RefSeq
Other Designations
myosin regulatory light chain 5|myosin, light polypeptide 5, regulatory|superfast myosin regulatory light chain 2
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com