MYL5 monoclonal antibody (M03), clone 3D12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
MYL5 monoclonal antibody (M03), clone 3D12. Western Blot analysis of MYL5 expression in human colon.
Western Blot (Cell lysate)
MYL5 monoclonal antibody (M03), clone 3D12. Western Blot analysis of MYL5 expression in Jurkat.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MYL5 is approximately 3ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.97 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MYL5.
Immunogen
MYL5 (NP_002468, 4 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYASLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKL
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.97 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
MYL5 monoclonal antibody (M03), clone 3D12. Western Blot analysis of MYL5 expression in human colon.Western Blot (Cell lysate)
MYL5 monoclonal antibody (M03), clone 3D12. Western Blot analysis of MYL5 expression in Jurkat.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MYL5 is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — MYL5
Entrez GeneID
4636GeneBank Accession#
NM_002477Protein Accession#
NP_002468Gene Name
MYL5
Gene Alias
-
Gene Description
myosin, light chain 5, regulatory
Omim ID
160782Gene Ontology
HyperlinkGene Summary
This gene encodes one of the myosin light chains, a component of the hexameric ATPase cellular motor protein myosin. Myosin is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene product, one of the regulatory light chains, is expressed in fetal muscle and in adult retina, cerebellum, and basal ganglia. [provided by RefSeq
Other Designations
myosin regulatory light chain 5|myosin, light polypeptide 5, regulatory|superfast myosin regulatory light chain 2
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com