CD99 monoclonal antibody (M01), clone 3A10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CD99 monoclonal antibody (M01), clone 3A10 Western Blot analysis of CD99 expression in K-562 ( Cat # L009V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of CD99 expression in transfected 293T cell line by CD99 monoclonal antibody (M01), clone 3A10.
Lane 1: CD99 transfected lysate(18.8 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CD99 is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant CD99.
Immunogen
CD99 (AAH03147, 23 a.a. ~ 122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEAD
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CD99 monoclonal antibody (M01), clone 3A10 Western Blot analysis of CD99 expression in K-562 ( Cat # L009V1 ).Western Blot (Transfected lysate)
Western Blot analysis of CD99 expression in transfected 293T cell line by CD99 monoclonal antibody (M01), clone 3A10.
Lane 1: CD99 transfected lysate(18.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CD99 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — CD99
Entrez GeneID
4267GeneBank Accession#
BC003147Protein Accession#
AAH03147Gene Name
CD99
Gene Alias
MIC2, MIC2X, MIC2Y
Gene Description
CD99 molecule
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a cell surface glycoprotein involved in leukocyte migration, T-cell adhesion, ganglioside GM1 and transmembrane protein transport, and T-cell death by a caspase-independent pathway. In addition, the encoded protein may have the ability to rearrange the actin cytoskeleton and may also act as an oncosuppressor in osteosarcoma. Cyclophilin A binds to CD99 and may act as a signaling regulator of CD99. This gene is found in the pseudoautosomal region of chromosomes X and Y and escapes X-chromosome inactivation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
CD99 antigen|E2 antigen|MIC2 (monoclonal antibody 12E7)|OTTHUMP00000022840|T-cell surface glycoprotein E2|antigen identified by monoclonal 12E7, Y homolog|antigen identified by monoclonal antibodies 12E7, F21 and O13|surface antigen MIC2
-
Interactomes
-
Pathways
-
Diseases
-
Publication Reference
-
Orbital infantile myofibroma: a case report and clinicopathologic review of 24 cases from the literature.
Mynatt CJ, Feldman KA, Thompson LD.
Head and Neck Pathology 2011 Sep; 5(3):205.
Application：IHC, Human, Myofibroma.
-
Orbital infantile myofibroma: a case report and clinicopathologic review of 24 cases from the literature.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com