IRF1 monoclonal antibody (M01), clone 2E4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant IRF1.
Immunogen
IRF1 (NP_002189, 216 a.a. ~ 325 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAP
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
IRF1 monoclonal antibody (M01), clone 2E4 Western Blot analysis of IRF1 expression in COLO 320 HSR ( Cat # L020V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged IRF1 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — IRF1
Entrez GeneID
3659GeneBank Accession#
NM_002198Protein Accession#
NP_002189Gene Name
IRF1
Gene Alias
IRF-1, MAR
Gene Description
interferon regulatory factor 1
Gene Ontology
HyperlinkGene Summary
IRF1 encodes interferon regulatory factor 1, a member of the interferon regulatory transcription factor (IRF) family. IRF1 serves as an activator of interferons alpha and beta transcription, and in mouse it has been shown to be required for double-stranded RNA induction of these genes. IRF1 also functions as a transcription activator of genes induced by interferons alpha, beta, and gamma. Further, IRF1 has been shown to play roles in regulating apoptosis and tumor-suppressoion. [provided by RefSeq
Other Designations
interferon regulatory factor-1
-
Interactomes
-
Diseases
-
Publication Reference
-
Defining critical roles for NF-κB p65 and type I interferon in innate immunity to rhinovirus.
Bartlett NW, Slater L, Glanville N, Haas JJ, Caramori G, Casolari P, Clarke DL, Message SD, Aniscenko J, Kebadze T, Zhu J, Mallia P, Mizgerd JP, Belvisi M, Papi A, Kotenko SV, Johnston SL, Edwards MR.
EMBO Molecular Medicine 2012 Dec; 4(12):1244.
Application:WB-Tr, Human, HBECs.
-
Defining critical roles for NF-κB p65 and type I interferon in innate immunity to rhinovirus.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com