HSPA1L monoclonal antibody (M02), clone 7H6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HSPA1L.
Immunogen
HSPA1L (NP_005518, 561 a.a. ~ 641 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KGKISESDKNKILDKCNELLSWLEVNQLAEKDEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD
Host
Mouse
Reactivity
Human, Rat
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.65 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
HSPA1L monoclonal antibody (M02), clone 7H6. Western Blot analysis of HSPA1L expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
HSPA1L monoclonal antibody (M02), clone 7H6 Western Blot analysis of HSPA1L expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to HSPA1L on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HSPA1L is approximately 0.1ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between MAP3K7 and HSPA1L. HeLa cells were stained with anti-MAP3K7 rabbit purified polyclonal 1:1200 and anti-HSPA1L mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — HSPA1L
Entrez GeneID
3305GeneBank Accession#
NM_005527Protein Accession#
NP_005518Gene Name
HSPA1L
Gene Alias
HSP70-1L, HSP70-HOM, HSP70T, hum70t
Gene Description
heat shock 70kDa protein 1-like
Omim ID
140559Gene Ontology
HyperlinkGene Summary
This gene encodes a 70kDa heat shock protein. In conjunction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. The gene is located in the major histocompatibility complex class III region, in a cluster with two closely related genes which also encode isoforms of the 70kDa heat shock protein. [provided by RefSeq
Other Designations
OTTHUMP00000029295|heat shock 10kDa protein 1-like|heat shock 70kD protein-like 1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com