HSPA1L monoclonal antibody (M01), clone 1B5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
HSPA1L monoclonal antibody (M01), clone 1B5. Western Blot analysis of HSPA1L expression in HeLa ( Cat # L013V1 ).
Western Blot (Cell lysate)
HSPA1L monoclonal antibody (M01), clone 1B5. Western Blot analysis of HSPA1L expression in PC-12 ( Cat # L012V1 ).
Western Blot detection against Immunogen (34.65 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HSPA1L.
Immunogen
HSPA1L (NP_005518, 561 a.a. ~ 641 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KGKISESDKNKILDKCNELLSWLEVNQLAEKDEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD
Host
Mouse
Reactivity
Human, Rat
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.65 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
HSPA1L monoclonal antibody (M01), clone 1B5. Western Blot analysis of HSPA1L expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
HSPA1L monoclonal antibody (M01), clone 1B5. Western Blot analysis of HSPA1L expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — HSPA1L
Entrez GeneID
3305GeneBank Accession#
NM_005527Protein Accession#
NP_005518Gene Name
HSPA1L
Gene Alias
HSP70-1L, HSP70-HOM, HSP70T, hum70t
Gene Description
heat shock 70kDa protein 1-like
Omim ID
140559Gene Ontology
HyperlinkGene Summary
This gene encodes a 70kDa heat shock protein. In conjunction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. The gene is located in the major histocompatibility complex class III region, in a cluster with two closely related genes which also encode isoforms of the 70kDa heat shock protein. [provided by RefSeq
Other Designations
OTTHUMP00000029295|heat shock 10kDa protein 1-like|heat shock 70kD protein-like 1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com