HMGB1 monoclonal antibody (M01), clone 1E6-E10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant HMGB1.
Immunogen
HMGB1 (AAH03378.1, 1 a.a. ~ 215 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of HMGB1 expression in transfected 293T cell line by HMGB1 monoclonal antibody (M01), clone 1E6-E10.
Lane 1: HMGB1 transfected lysate(25 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to HMGB1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HMGB1 is 0.03 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to HMGB1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — HMGB1
Entrez GeneID
3146GeneBank Accession#
BC003378Protein Accession#
AAH03378.1Gene Name
HMGB1
Gene Alias
DKFZp686A04236, HMG1, HMG3, SBP-1
Gene Description
high-mobility group box 1
Omim ID
163905Gene Ontology
HyperlinkOther Designations
Amphoterin|OTTHUMP00000018199|OTTHUMP00000190860|Sulfoglucuronyl carbohydrate binding protein|high mobility group box 1|high mobility group protein 1|high-mobility group (nonhistone chromosomal) protein 1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
JH-4 reduces HMGB1-mediated septic responses and improves survival rate in septic mice.
Lee W, Yuseok O, Yang S, Lee BS, Lee JH, Park EK, Baek MC, Song GY, Bae JS.
Journal of Cellular Biochemistry 2019 Apr; 120(4):6277.
Application:C-ELISA, Human, Mouse, HUVECs, Mouse serum.
-
Persicarin is anti-inflammatory mediator against HMGB1-induced inflammatory responses in HUVECs and in CLP-induced sepsis mice.
Kim TH, Ku SK, Bae JS.
Journal of Cellular Physiology 2013 Apr; 228(4):696.
Application:C-ELISA, Human, HUVECs culture medium.
-
Emodin-6-O-β-D-glucoside inhibits HMGB1-induced inflammatory responses in vitro and in vivo.
Lee W, Ku SK, Kim TH, Bae JS.
Food and Chemical Toxicology 2013 Feb; 52:97.
Application:ELISA, Mouse, Mouse serum.
-
JH-4 reduces HMGB1-mediated septic responses and improves survival rate in septic mice.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com