GTF2A2 purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of GTF2A2 expression in transfected 293T cell line (H00002958-T02) by GTF2A2 MaxPab polyclonal antibody.
Lane 1: GTF2A2 transfected lysate(11.99 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to GTF2A2 on HepG2 cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human GTF2A2 protein.
Immunogen
GTF2A2 (NP_004483.1, 1 a.a. ~ 109 a.a) full-length human protein.
Sequence
MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of GTF2A2 expression in transfected 293T cell line (H00002958-T02) by GTF2A2 MaxPab polyclonal antibody.
Lane 1: GTF2A2 transfected lysate(11.99 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to GTF2A2 on HepG2 cell. [antibody concentration 10 ug/ml] -
Gene Info — GTF2A2
Entrez GeneID
2958GeneBank Accession#
NM_004492.1Protein Accession#
NP_004483.1Gene Name
GTF2A2
Gene Alias
HsT18745, TF2A2, TFIIA
Gene Description
general transcription factor IIA, 2, 12kDa
Omim ID
600519Gene Ontology
HyperlinkGene Summary
Accurate transcription initiation on TATA-containing class II genes involves the ordered assembly of RNA polymerase II (POLR2A; MIM 180660) and the general initiation factors TFIIA, TFIIB (MIM 189963), TFIID (MIM 313650), TFIIE (MIM 189962), TFIIF (MIM 189968), TFIIG/TFIIJ, and TFIIH (MIM 189972). The first step involves recognition of the TATA element by the TATA-binding subunit (TBP; MIM 600075) and may be regulated by TFIIA, a factor that interacts with both TBP and a TBP-associated factor (TAF; MIM 600475) in TFIID. TFIIA has 2 subunits (43 and 12 kD) in yeast and 3 subunits in higher eukaryotes. In HeLa extracts, it consists of a 35-kD alpha subunit and a 19-kD beta subunit encoded by the N- and C-terminal regions of GTF2A1 (MIM 600520), respectively, and a 12-kD gamma subunit encoded by GTF2A2 (DeJong et al., 1995 [PubMed 7724559]).[supplied by OMIM
Other Designations
OTTHUMP00000196512|OTTHUMP00000196515|general transcription factor IIA, 2 (12kD subunit)
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com