NR3C1 monoclonal antibody (M01), clone 2C8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
NR3C1 monoclonal antibody (M01), clone 2C8. Western Blot analysis of NR3C1 expression in HeLa ( Cat # L013V1 ).
Western Blot (Cell lysate)
NR3C1 monoclonal antibody (M01), clone 2C8 Western Blot analysis of NR3C1 expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Transfected lysate)
Western Blot analysis of NR3C1 expression in transfected 293T cell line by NR3C1 monoclonal antibody (M01), clone 2C8.
Lane 1: NR3C1 transfected lysate(85.7 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NR3C1 is approximately 0.1ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to NR3C1 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (35.53 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NR3C1.
Immunogen
NR3C1 (AAH15610, 51 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPK
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.53 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NR3C1 monoclonal antibody (M01), clone 2C8. Western Blot analysis of NR3C1 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
NR3C1 monoclonal antibody (M01), clone 2C8 Western Blot analysis of NR3C1 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of NR3C1 expression in transfected 293T cell line by NR3C1 monoclonal antibody (M01), clone 2C8.
Lane 1: NR3C1 transfected lysate(85.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NR3C1 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to NR3C1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — NR3C1
Entrez GeneID
2908GeneBank Accession#
BC015610Protein Accession#
AAH15610Gene Name
NR3C1
Gene Alias
GCCR, GCR, GR, GRL
Gene Description
nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor)
Omim ID
138040Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a receptor for glucocorticoids that can act as both a transcription factor and as a regulator of other transcription factors. This protein can also be found in heteromeric cytoplasmic complexes along with heat shock factors and immunophilins. The protein is typically found in the cytoplasm until it binds a ligand, which induces transport into the nucleus. Mutations in this gene are a cause of glucocorticoid resistance, or cortisol, resistance. Alternate splicing, the use of at least three different promoters, and alternate translation initiation sites result in several transcript variants encoding the same protein or different isoforms, but the full-length nature of some variants has not been determined. [provided by RefSeq
Other Designations
nuclear receptor subfamily 3, group C, member 1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com