FMR1 monoclonal antibody (M01), clone 2D4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant FMR1.
Immunogen
FMR1 (NP_002015, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ATKDTFHKIKLDVPEDLRQMCAKEAAHKDFKKAVGAFSVTYDPENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIMRNEEASKQLESSRQLASRFH
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
FMR1 monoclonal antibody (M01), clone 2D4 Western Blot analysis of FMR1 expression in HepG2 ( Cat # L019V1 ).Western Blot (Transfected lysate)
Western Blot analysis of FMR1 expression in transfected 293T cell line by FMR1 monoclonal antibody (M01), clone 2D4.
Lane 1: FMR1 transfected lysate(34.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FMR1 is approximately 0.1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of FMR1 over-expressed 293 cell line, cotransfected with FMR1 Validated Chimera RNAi ( Cat # H00002332-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with FMR1 monoclonal antibody (M01), clone 2D4 (Cat # H00002332-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — FMR1
Entrez GeneID
2332GeneBank Accession#
NM_002024Protein Accession#
NP_002015Gene Name
FMR1
Gene Alias
FMRP, FRAXA, MGC87458, POF, POF1
Gene Description
fragile X mental retardation 1
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene binds RNA and is associated with polysomes. The encoded protein may be involved in mRNA trafficking from the nucleus to the cytoplasm. A trinucleotide repeat (CGG) in the 5' UTR is normally found at 6-53 copies, but an expansion to 55-230 repeats is the cause of fragile X syndrome. Expansion of the trinucleotide repeat may also cause one form of premature ovarian failure (POF1). [provided by RefSeq
Other Designations
OTTHUMP00000024197|premature ovarian failure 1
-
Interactomes
-
Diseases
-
Publication Reference
-
Splicing of exon 9a in FMR1 transcripts results in a truncated FMRP with altered subcellular distribution.
Fu XG, Yan AZ, Xu YJ, Liao J, Guo XY, Zhang D, Yang WJ, Zheng DZ, Lan FH.
Gene 2020 Mar; 731:144359.
Application:IF, WB-Tr, Human, HeLa, HEK 293T cells.
-
Splicing of exon 9a in FMR1 transcripts results in a truncated FMRP with altered subcellular distribution.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com