PHC2 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of PHC2 expression in transfected 293T cell line (H00001912-T01) by PHC2 MaxPab polyclonal antibody.
Lane 1: PHC2 transfected lysate(35.53 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human PHC2 protein.
Immunogen
PHC2 (NP_004418.2, 1 a.a. ~ 323 a.a) full-length human protein.
Sequence
MTSGNGNSASSIAGTAPQNGENKPPQAIVKPQILTHVIEGFVIQEGAEPFPVGRSSLLVGNLKKKYAQGFLPEKLPQQDHTTTTDSEMEEPYLQESKEEGAPLKLKCELCGRVDFAYKFKRSKRFCSMACAKRYNVGCTKRVGLFHSDRSKLQKAGAATHNRRRASKASLPPLTKDTKKQPTGTVPLSVTAALQLTHSQEDSSRCSDNSSYEEPLSPISASSSTSRRRQGQRDLELPDMHMRDLVGMGHHFLPSEPTKWNVEDVYEFIRSLPGCQEIAEEFRAQEIDGQALLLLKEDHLMSAMNIKLGPALKIYARISMLKDS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (98)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PHC2 expression in transfected 293T cell line (H00001912-T01) by PHC2 MaxPab polyclonal antibody.
Lane 1: PHC2 transfected lysate(35.53 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — PHC2
Entrez GeneID
1912GeneBank Accession#
NM_004427Protein Accession#
NP_004418.2Gene Name
PHC2
Gene Alias
EDR2, HPH2, MGC163502, PH2
Gene Description
polyhomeotic homolog 2 (Drosophila)
Omim ID
602979Gene Ontology
HyperlinkGene Summary
In Drosophila melanogaster, the 'Polycomb' group (PcG) of genes are part of a cellular memory system that is responsible for the stable inheritance of gene activity. PcG proteins form a large multimeric, chromatin-associated protein complex. The protein encoded by this gene has homology to the Drosophila PcG protein 'polyhomeotic' (Ph) and is known to heterodimerize with EDR1 and colocalize with BMI1 in interphase nuclei of human cells. The specific function in human cells has not yet been determined. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000004292|OTTHUMP00000004294|early development regulator 2 (homolog of polyhomeotic 2)|early development regulator 2-like|polyhomeotic 2|polyhomeotic-like 2
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com