Product Browser

Last updated: 2017/6/18

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CSNK2B (Human) Recombinant Protein (P01)

  • Catalog # : H00001460-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CSNK2B full-length ORF ( NP_001311.3, 1 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 51.3
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001460-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1460
  • Gene Name:
  • CSNK2B
  • Gene Alias:
  • CK2B,CK2N,CSK2B,G5A,MGC138222,MGC138224
  • Gene Description:
  • casein kinase 2, beta polypeptide
  • Gene Summary:
  • This gene encodes the beta subunit of casein kinase II, a ubiquitous protein kinase which regulates metabolic pathways, signal transduction, transcription, translation, and replication. The enzyme is composed of three subunits, alpha, alpha prime and beta, which form a tetrameric holoenzyme. The alpha and alpha prime subunits are catalytic, while the beta subunit serves regulatory functions. The enzyme localizes to the endoplasmic reticulum and the Golgi apparatus. [provided by RefSeq
  • Other Designations:
  • Casein kinase II beta subunit,OTTHUMP00000029060,OTTHUMP00000029063,OTTHUMP00000029064,alternative name: G5a, phosvitin,phosvitin
  • RSS
  • YouTube
  • Linkedin
  • Facebook