CDX2 monoclonal antibody (M01), clone 1C7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
CDX2 monoclonal antibody (M01), clone 1C7. Western Blot analysis of CDX2 expression in human parotid gland.
Western Blot (Cell lysate)
CDX2 monoclonal antibody (M01), clone 1C7 Western Blot analysis of CDX2 expression in COLO 320 HSR ( Cat # L020V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CDX2 is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (60.17 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant CDX2.
Immunogen
CDX2 (AAH14461.1, 1 a.a. ~ 313 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGPNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPEPLSPVSSLQASVSGSVPGVLGPTGGVLNPTVTQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (93)
Isotype
IgG
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (60.17 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CDX2 monoclonal antibody (M01), clone 1C7. Western Blot analysis of CDX2 expression in human parotid gland.Western Blot (Cell lysate)
CDX2 monoclonal antibody (M01), clone 1C7 Western Blot analysis of CDX2 expression in COLO 320 HSR ( Cat # L020V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CDX2 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — CDX2
Entrez GeneID
1045GeneBank Accession#
BC014461Protein Accession#
AAH14461.1Gene Name
CDX2
Gene Alias
CDX-3, CDX3
Gene Description
caudal type homeobox 2
Omim ID
600297Gene Ontology
HyperlinkGene Summary
The level and beta-cell specificity of insulin gene expression are regulated by a set of nuclear proteins that bind to specific sequences within the promoter of the insulin gene (INS; MIM 176730) and interact with RNA polymerase to activate or repress transcription. The proteins LMX1 (MIM 600298) and CDX3 are homeodomain proteins that bind an A/T-rich sequence in the insulin promoter and stimulate its transcription (German et al., 1994 [PubMed 7698771]).[supplied by OMIM
Other Designations
OTTHUMP00000018176|caudal type homeo box transcription factor 2|caudal type homeobox transcription factor 2
-
Interactome
-
Disease
-
Publication Reference
-
Transcriptional control of the B3GALT5 gene by a retroviral promoter and methylation of distant regulatory elements.
Zulueta A, Caretti A, Signorelli P.
FASEB Journal 2014 Feb; 28(2):946.
Application：WB-Ce, Human, MCF-7, MDA-MB-231, MKN-45, KATOIII, HuCC-T1, HT-29, HCT-15, COLO-205, SW-116, HEK-293T/17, Huh7, Hep-3B cells.
-
Transcriptional control of the B3GALT5 gene by a retroviral promoter and methylation of distant regulatory elements.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com