BAK1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
BAK1 MaxPab rabbit polyclonal antibody. Western Blot analysis of BAK1 expression in A-431.
Western Blot (Transfected lysate)
Western Blot analysis of BAK1 expression in transfected 293T cell line (H00000578-T02) by BAK1 MaxPab polyclonal antibody.
Lane 1: BAK1 transfected lysate(23.40 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human BAK1 protein.
Immunogen
BAK1 (NP_001179.1, 1 a.a. ~ 211 a.a) full-length human protein.
Sequence
MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
BAK1 MaxPab rabbit polyclonal antibody. Western Blot analysis of BAK1 expression in A-431.Western Blot (Transfected lysate)
Western Blot analysis of BAK1 expression in transfected 293T cell line (H00000578-T02) by BAK1 MaxPab polyclonal antibody.
Lane 1: BAK1 transfected lysate(23.40 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — BAK1
Entrez GeneID
578GeneBank Accession#
NM_001188Protein Accession#
NP_001179.1Gene Name
BAK1
Gene Alias
BAK, BAK-LIKE, BCL2L7, CDN1, MGC117255, MGC3887
Gene Description
BCL2-antagonist/killer 1
Omim ID
600516Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mitochondria, and functions to induce apoptosis. It interacts with and accelerates the opening of the mitochondrial voltage-dependent anion channel, which leads to a loss in membrane potential and the release of cytochrome c. This protein also interacts with the tumor suppressor P53 after exposure to cell stress. [provided by RefSeq
Other Designations
BCL2-like 7 protein|Bcl-2 homologous antagonist/killer|OTTHUMP00000016211|OTTHUMP00000039620|apoptosis regulator BAK|pro-apoptotic protein BAK
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com