NPC2 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human NPC2 protein.
Immunogen
NPC2 (NP_006423.1, 1 a.a. ~ 151 a.a) full-length human protein.
Sequence
MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL
Host
Rabbit
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (81); Rat (80)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
NPC2 MaxPab rabbit polyclonal antibody. Western Blot analysis of NPC2 expression in mouse lung.Western Blot (Tissue lysate)
NPC2 MaxPab rabbit polyclonal antibody. Western Blot analysis of NPC2 expression in human kidney.Western Blot (Cell lysate)
NPC2 MaxPab rabbit polyclonal antibody. Western Blot analysis of NPC2 expression in PC-12.Western Blot (Transfected lysate)
Western Blot analysis of NPC2 expression in transfected 293T cell line (H00010577-T02) by NPC2 MaxPab polyclonal antibody.
Lane 1: NPC2 transfected lysate(16.60 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — NPC2
Entrez GeneID
10577GeneBank Accession#
NM_006432.3Protein Accession#
NP_006423.1Gene Name
NPC2
Gene Alias
HE1, MGC1333, NP-C2
Gene Description
Niemann-Pick disease, type C2
Gene Ontology
HyperlinkGene Summary
This gene encodes a protein containing a lipid recognition domain. The encoded protein may function in regulating the transport of cholesterol through the late endosomal/lysosomal system. Mutations in this gene have been associated with Niemann-Pick disease, type C2 and frontal lobe atrophy. [provided by RefSeq
Other Designations
epididymal secretory protein|epididymal secretory protein E1|tissue-specific secretory protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com