CTSE purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
CTSE MaxPab polyclonal antibody. Western Blot analysis of CTSE expression in human stomach.
Western Blot (Transfected lysate)
Western Blot analysis of CTSE expression in transfected 293T cell line (H00001510-T01) by CTSE MaxPab polyclonal antibody.
Lane 1: CTSE transfected lysate(43.67 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human CTSE protein.
Immunogen
CTSE (AAH42537, 18 a.a. ~ 396 a.a) full-length human protein.
Sequence
QGSLHRVPLRRHPTLKKKLRARSQLSEFWKSHNLDMIQFTESCSMDQSAKEPLINYLDMEYFGTISIGSPPQNFTVIFDTGSSNLWVPSVYCTSPACKTHSRFQPSQSSTYSQPGQSFSIQYGTGSLSGIIGADQVSVEGLTVVGQQFGESVTEPGQTLVDAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSVYMSSNPEGGAGSELIFGGYDHSHFSGSLNWVPVTKQAYWQIALDNIQVGGTVMFCSEGCQAIVDTGTSLITGPSDKIKQLQNAIGAAPVDGEYAVECANLNVMPDVTFTINGVPYTLSPTAYTLLDFVDGMQFCSSGFQGLDIHPPAGPLWILGDVFIRQFYSVFDRGNNRVGLAPAVP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (83); Rat (77)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CTSE MaxPab polyclonal antibody. Western Blot analysis of CTSE expression in human stomach.Western Blot (Transfected lysate)
Western Blot analysis of CTSE expression in transfected 293T cell line (H00001510-T01) by CTSE MaxPab polyclonal antibody.
Lane 1: CTSE transfected lysate(43.67 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CTSE
Entrez GeneID
1510GeneBank Accession#
BC042537Protein Accession#
-Gene Name
CTSE
Gene Alias
CATE
Gene Description
cathepsin E
Omim ID
116890Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a gastric aspartyl protease that functions as a disulfide-linked homodimer. This protease, which is a member of the peptidase C1 family, has a specificity similar to that of pepsin A and cathepsin D. It is an intracellular proteinase that does not appear to be involved in the digestion of dietary protein and is found in highest concentration in the surface of epithelial mucus-producing cells of the stomach. It is the first aspartic proteinase expressed in the fetal stomach and is found in more than half of gastric cancers. It appears, therefore, to be an oncofetal antigen. Transcript variants utilizing alternative polyadenylation signals and two transcript variants encoding different isoforms exist for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000034345|OTTHUMP00000034346|erythrocyte membrane aspartic proteinase|slow-moving proteinase
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com