TAGLN polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
Western Blot analysis of human heart tissue.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human gallbladder shows strong cytoplasmic positivity in smooth muscle cells.
Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria & microtubules. Antibody staining is shown in green.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human TAGLN.
Immunogen
Recombinant protein corresponding to amino acids 19-94 of human TAGLN.
Sequence
EKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQV
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (0.4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Tissue lysate)
Western Blot analysis of human heart tissue.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human gallbladder shows strong cytoplasmic positivity in smooth muscle cells.Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria & microtubules. Antibody staining is shown in green. -
Gene Info — TAGLN
Entrez GeneID
6876Protein Accession#
Q01995Gene Name
TAGLN
Gene Alias
DKFZp686P11128, SM22, SMCC, TAGLN1, WS3-10
Gene Description
transgelin
Omim ID
600818Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a transformation and shape-change sensitive actin cross-linking/gelling protein found in fibroblasts and smooth muscle. Its expression is down-regulated in many cell lines, and this down-regulation may be an early and sensitive marker for the onset of transformation. A functional role of this protein is unclear. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
SM22-alpha|transgelin variant 2
-
Interactome
-
Disease
-
Publication Reference
-
Stromal contribution to the colorectal cancer transcriptome.
Isella C, Terrasi A, Bellomo SE, Petti C, Galatola G, Muratore A, Mellano A, Senetta R, Cassenti A, Sonetto C, Inghirami G, Trusolino L, Fekete Z, De Ridder M, Cassoni P, Storme G, Bertotti A, Medico E.
Nature Genetics 2015 Apr; 47(4):312.
Application：IHC-P, Human, Human colorectal cancer.
-
Stromal contribution to the colorectal cancer transcriptome.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com