STAT6 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells), Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla) with STAT6 polyclonal antibody at 1:100-1:500 dilution.
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: A-431, Lane 4: Liver, Lane 5: Tonsil with STAT6 polyclonal antibody at 1:100-1:250 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human urinary bladder with STAT6 polyclonal antibody (Cat # PAB28498) shows strong cytoplasmic and nuclear positivity in urothelial cells at 1:50-1:200 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with STAT6 polyclonal antibody (Cat # PAB28498) at 1-4 ug/ml shows positivity in nucleus but not nucleoli & cytoplasm.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant STAT6.
Immunogen
Recombinant protein corresponding to amino acids of human STAT6
Sequence
VYPPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMDLR
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry(1:50-1:200)
Western Blot(1:100-1:250)
Immunofluorescence(1-4 ug/ml)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells), Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla) with STAT6 polyclonal antibody at 1:100-1:500 dilution.Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: A-431, Lane 4: Liver, Lane 5: Tonsil with STAT6 polyclonal antibody at 1:100-1:250 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human urinary bladder with STAT6 polyclonal antibody (Cat # PAB28498) shows strong cytoplasmic and nuclear positivity in urothelial cells at 1:50-1:200 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with STAT6 polyclonal antibody (Cat # PAB28498) at 1-4 ug/ml shows positivity in nucleus but not nucleoli & cytoplasm. -
Gene Info — STAT6
Entrez GeneID
6778Protein Accession#
F5GXI9Gene Name
STAT6
Gene Alias
D12S1644, IL-4-STAT, STAT6B, STAT6C
Gene Description
signal transducer and activator of transcription 6, interleukin-4 induced
Omim ID
601512Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2) cells, expression of cell surface markers, and class switch of immunoglobulins. [provided by RefSeq
Other Designations
STAT, interleukin4-induced|signal transducer and activator of transcription 6|transcription factor IL-4 STAT
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com