CD8A monoclonal antibody, clone CL1529
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against partial recombinant human CD8A.
Immunogen
Recombinant protein corresponding to amino acids 64-147 of human CD8A.
Sequence
AASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPT
Host
Mouse
Reactivity
Human
Form
Liquid
Purification
Protein A purification
Isotype
IgG1
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human fallopian tube with CD8A monoclonal antibody, clone CL1529 (Cat # MAB15532) shows strong positivity in a subset of lymphoid cells.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human rectum with CD8A monoclonal antibody, clone CL1529 (Cat # MAB15532) shows strong positivity in a subset of lymphoid cells in lamina propria.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human small intestine with CD8A monoclonal antibody, clone CL1529 (Cat # MAB15532) shows strong immunoreactivity in a subset of lymphoid cells in lamina propria.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human tonsil with CD8A monoclonal antibody, clone CL1529 (Cat # MAB15532) shows strong immunoreactivity in a subset of lymphoid cells outside the reaction centra. -
Gene Info — CD8A
Entrez GeneID
925Protein Accession#
P01732Gene Name
CD8A
Gene Alias
CD8, Leu2, MAL, p32
Gene Description
CD8a molecule
Gene Ontology
HyperlinkGene Summary
The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen acts as a corepressor with the T-cell receptor on the T lymphocyte to recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. The coreceptor functions as either a homodimer composed of two alpha chains, or as a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 alpha chain isoforms. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
CD8 antigen alpha polypeptide|CD8 antigen, alpha polypeptide (p32)|Leu2 T-lymphocyte antigen|OKT8 T-cell antigen|T cell co-receptor|T-cell antigen Leu2|T-cell surface glycoprotein CD8 alpha chain|T-lymphocyte differentiation antigen T8/Leu-2|T8 T-cell ant
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com