IL21 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human IL21 protein.
Immunogen
IL21 (NP_068575.1, 1 a.a. ~ 162 a.a) full-length human protein.
Sequence
MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (63); Rat (60)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
IL21 MaxPab rabbit polyclonal antibody. Western Blot analysis of IL21 expression in mouse kidney.Western Blot (Tissue lysate)
IL21 MaxPab rabbit polyclonal antibody. Western Blot analysis of IL21 expression in human liver.Western Blot (Cell lysate)
IL21 MaxPab rabbit polyclonal antibody. Western Blot analysis of IL21 expression in A-431.Western Blot (Transfected lysate)
Western Blot analysis of IL21 expression in transfected 293T cell line (H00059067-T02) by IL21 MaxPab polyclonal antibody.
Lane 1: IL21 transfected lysate(18.70 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between IL21 and DGKA. HeLa cells were stained with anti-IL21 rabbit purified polyclonal 1:1200 and anti-DGKA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — IL21
Entrez GeneID
59067GeneBank Accession#
NM_021803Protein Accession#
NP_068575.1Gene Name
IL21
Gene Alias
IL-21, Za11
Gene Description
interleukin 21
Omim ID
605384Gene Ontology
HyperlinkOther Designations
interleukin-21 isoform
-
Pathway
-
Disease
- Addison Disease
- Alopecia Areata
- Arthritis
- Asthma
- Autoimmune Diseases
- Bronchiolitis
- Carcinoma
- Celiac Disease
- Colitis
+ View More Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com