ANAPC5 MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
ANAPC5 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANAPC5 expression in mouse spleen.
Western Blot (Tissue lysate)
ANAPC5 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANAPC5 expression in mouse liver.
Western Blot (Cell lysate)
ANAPC5 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANAPC5 expression in HeLa.
Western Blot (Cell lysate)
ANAPC5 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANAPC5 expression in Raw 264.7.
Western Blot (Cell lysate)
ANAPC5 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANAPC5 expression in NIH/3T3.
Western Blot (Cell lysate)
ANAPC5 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANAPC5 expression in PC-12.
Western Blot (Transfected lysate)
Western Blot analysis of ANAPC5 expression in transfected 293T cell line (H00051433-T01) by ANAPC5 MaxPab polyclonal antibody.
Lane 1: ANAPC5 transfected lysate(85.1 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of ANAPC5 transfected lysate using anti-ANAPC5 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with ANAPC5 purified MaxPab mouse polyclonal antibody (B01P) (H00051433-B01P).
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human ANAPC5 protein.
Immunogen
ANAPC5 (NP_057321.2, 1 a.a. ~ 755 a.a) full-length human protein.
Sequence
MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLNEMSRTGEGAVSLMERRRLNQLLLPLLQGPDITLSKLYKLIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFSGTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQYFQNGEKKTVEDADMELTSRDEGERKMEKEELDVSVREEEVSCSGPLSQKQAEFFLSQQASLLKNDETKALTPASLQKELNNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSLRYAALNLAALHCRFGHYQQAELALQEAIRIAQESNDHVCLQHCLSWLYVLGQKRSDSYVLLEHSVKKAVHFGLPYLASLGIQSLVQQRAFAGKTANKLMDALKDSDLLHWKHSLSELIDISIAQKTAIWRLYGRSTMALQQAQMLLSMNSLEAVNAGVQQNNTESFAVALCHLAELHAEQGCFAAASEVLKHLKERFPPNSQHAQLWMLCDQKIQFDRAMNDGKYHLADSLVTGITALNSIEGVYRKAVVLQAQNQMSEAHKLLQKLLVHCQKLKNTEMVISVLLSVAELYWRSSSPTIALPMLLQALALSKEYRLQYLASETVLNLAFAQLILGIPEQALSLLHMAIEPILADGAILDKGRAMFLVAKCQVASAASYDQPKKAEALEAAIENLNEAKNYFAKVDCKERIRDVVYFQARLYHTLGKTQERNRCAMLFRQLHQELPSHGVPLINHL
Host
Rabbit
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (94); Rat (93)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
ANAPC5 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANAPC5 expression in mouse spleen.Western Blot (Tissue lysate)
ANAPC5 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANAPC5 expression in mouse liver.Western Blot (Cell lysate)
ANAPC5 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANAPC5 expression in HeLa.Western Blot (Cell lysate)
ANAPC5 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANAPC5 expression in Raw 264.7.Western Blot (Cell lysate)
ANAPC5 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANAPC5 expression in NIH/3T3.Western Blot (Cell lysate)
ANAPC5 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANAPC5 expression in PC-12.Western Blot (Transfected lysate)
Western Blot analysis of ANAPC5 expression in transfected 293T cell line (H00051433-T01) by ANAPC5 MaxPab polyclonal antibody.
Lane 1: ANAPC5 transfected lysate(85.1 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of ANAPC5 transfected lysate using anti-ANAPC5 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with ANAPC5 purified MaxPab mouse polyclonal antibody (B01P) (H00051433-B01P). -
Gene Info — ANAPC5
Entrez GeneID
51433GeneBank Accession#
NM_016237.3Protein Accession#
NP_057321.2Gene Name
ANAPC5
Gene Alias
APC5
Gene Description
anaphase promoting complex subunit 5
Omim ID
606948Gene Ontology
HyperlinkGene Summary
This gene encodes a tetratricopeptide repeat-containing component of the anaphase promoting complex/cyclosome (APC/C), a large E3 ubiquitin ligase that controls cell cycle progression by targeting a number of cell cycle regulators such as B-type cyclins for 26S proteasome-mediated degradation through ubiquitination. The encoded protein is required for the proper ubiquitination function of APC/C and for the interaction of APC/C with transcription coactivators. It also interacts with polyA binding protein and represses internal ribosome entry site-mediated translation. Multiple transcript variants encoding different isoforms have been found for this gene. These differences cause translation initiation at a downstream AUG and result in a shorter protein (isoform b), compared to isoform a. [provided by RefSeq
Other Designations
anaphase-promoting complex subunit 5|cyclosome subunit 5
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com