ACTL7B MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human ACTL7B protein.
Immunogen
ACTL7B (NP_006677.1, 1 a.a. ~ 415 a.a) full-length human protein.
Sequence
MATRNSPMPLGTAQGDPGEAGTRPGPDASLRDTGAATQLKMKPRKVHKIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVGHELLNTEAPLKLVNPLKHGIVVDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREKYAELMFETFGIPAMHVTSQSLLSIYSYGKTSGLVVESGHGVSHVVPISEGDVLPGLTSRADYAGGDLTNYLMQLLNEAGHAFTDDHLHIIEHIKKKCCYAAFLPEEELGLVPEELRVDYELPDGKLITIGQERFRCSEMLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMAANVLLCGGCTMLDGFPERFQRELSLLCPGDSPAVAAAPERKTSVWTGGSILASLQAFQQLWVSKEEFEERGSVAIYSKC
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (85); Rat (87)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ACTL7B expression in transfected 293T cell line (H00010880-T01) by ACTL7B MaxPab polyclonal antibody.
Lane 1: ACTL7B transfected lysate(45.2 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of ACTL7B transfected lysate using anti-ACTL7B MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with ACTL7B purified MaxPab mouse polyclonal antibody (B01P) (H00010880-B01P). -
Gene Info — ACTL7B
Entrez GeneID
10880GeneBank Accession#
NM_006686.2Protein Accession#
NP_006677.1Gene Name
ACTL7B
Gene Alias
-
Gene Description
actin-like 7B
Omim ID
604304Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This gene (ACTL7B), and related gene, ACTL7A, are intronless, and are located approximately 4 kb apart in a head-to-head orientation within the familial dysautonomia candidate region on 9q31. Based on mutational analysis of the ACTL7B gene in patients with this disorder, it was concluded that it is unlikely to be involved in the pathogenesis of dysautonomia. Unlike ACTL7A, the ACTL7B gene is expressed predominantly in the testis, however, its exact function is not known. [provided by RefSeq
Other Designations
OTTHUMP00000021867|actin-like 7-beta
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com