YWHAG monoclonal antibody (M02), clone 6A10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant YWHAG.
Immunogen
YWHAG (NP_036611, 70 a.a. ~ 169 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTH
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
YWHAG monoclonal antibody (M02), clone 6A10 Western Blot analysis of YWHAG expression in K-562 ( Cat # L009V1 ).Western Blot (Cell lysate)
YWHAG monoclonal antibody (M02), clone 6A10. Western Blot analysis of YWHAG expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
YWHAG monoclonal antibody (M02), clone 6A10. Western Blot analysis of YWHAG expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
YWHAG monoclonal antibody (M02), clone 6A10. Western Blot analysis of YWHAG expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
YWHAG monoclonal antibody (M02), clone 6A10. Western Blot analysis of YWHAG expression in IMR-32 ( Cat # L008V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged YWHAG is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — YWHAG
Entrez GeneID
7532GeneBank Accession#
NM_012479Protein Accession#
NP_036611Gene Name
YWHAG
Gene Alias
14-3-3GAMMA
Gene Description
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide
Omim ID
605356Gene Ontology
HyperlinkGene Summary
This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the rat ortholog. It is induced by growth factors in human vascular smooth muscle cells, and is also highly expressed in skeletal and heart muscles, suggesting an important role for this protein in muscle tissue. It has been shown to interact with RAF1 and protein kinase C, proteins involved in various signal transduction pathways. [provided by RefSeq
Other Designations
14-3-3 gamma
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com