YWHAG purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of YWHAG expression in transfected 293T cell line (H00007532-T02) by YWHAG MaxPab polyclonal antibody.
Lane 1: YWHAG transfected lysate(28.30 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human YWHAG protein.
Immunogen
YWHAG (NP_036611.2, 1 a.a. ~ 247 a.a) full-length human protein.
Sequence
MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of YWHAG expression in transfected 293T cell line (H00007532-T02) by YWHAG MaxPab polyclonal antibody.
Lane 1: YWHAG transfected lysate(28.30 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — YWHAG
Entrez GeneID
7532GeneBank Accession#
NM_012479.2Protein Accession#
NP_036611.2Gene Name
YWHAG
Gene Alias
14-3-3GAMMA
Gene Description
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide
Omim ID
605356Gene Ontology
HyperlinkGene Summary
This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the rat ortholog. It is induced by growth factors in human vascular smooth muscle cells, and is also highly expressed in skeletal and heart muscles, suggesting an important role for this protein in muscle tissue. It has been shown to interact with RAF1 and protein kinase C, proteins involved in various signal transduction pathways. [provided by RefSeq
Other Designations
14-3-3 gamma
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com