TCF2 monoclonal antibody (M06), clone 4E9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TCF2.
Immunogen
TCF2 (NP_000449, 29 a.a. ~ 118 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDP
Host
Mouse
Reactivity
Human, Mouse, Rat
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.90 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TCF2 monoclonal antibody (M06), clone 4E9. Western Blot analysis of TCF2 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
TCF2 monoclonal antibody (M06), clone 4E9. Western Blot analysis of TCF2 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
TCF2 monoclonal antibody (M06), clone 4E9. Western Blot analysis of TCF2 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
TCF2 monoclonal antibody (M06), clone 4E9. Western Blot analysis of TCF2 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — HNF1B
Entrez GeneID
6928GeneBank Accession#
NM_000458Protein Accession#
NP_000449Gene Name
HNF1B
Gene Alias
FJHN, HNF1beta, HNF2, HPC11, LF-B3, LFB3, MODY5, TCF2, VHNF1
Gene Description
HNF1 homeobox B
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the homeodomain-containing superfamily of transcription factors. The protein binds to DNA as either a homodimer, or a heterodimer with the related protein hepatocyte nuclear factor 1-alpha. The gene has been shown to function in nephron development, and regulates development of the embryonic pancreas. Mutations in this gene result in renal cysts and diabetes syndrome and noninsulin-dependent diabetes mellitus, and expression of this gene is altered in some types of cancer. Multiple transcript variants encoding different isoforms have been found for this gene
Other Designations
transcription factor 2|transcription factor 2, hepatic|transcription factor 2, hepatic; LF-B3; variant hepatic nuclear factor
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com