HNF1B monoclonal antibody, clone CL0374
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against partial recombinant human HNF1B.
Immunogen
Recombinant protein corresponding to human HNF1B.
Epitope
This antibody binds to an epitope located within the peptide sequence TPPILKELQA as determined by overlapping synthetic peptides.
Sequence
KEVLVQALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQH
Host
Mouse
Reactivity
Human
Form
Liquid
Purification
Protein A purification
Isotype
IgG1
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of Lane 1: negative control (vector only transfected HEK293T cell lysate) and Lane 2: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells) with HNF1B monoclonal antibody, clone CL0374 (Cat # MAB15622).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with HNF1B monoclonal antibody, clone CL0374 (Cat # MAB15622) shows moderate to strong nuclear immunoreactivity in renal tubules.Immunofluorescence
Immunofluorescent staining of A549 cells with HNF1B monoclonal antibody, clone CL0374 (Cat # MAB15622) (Green) shows spotty nuclear (without nucleoli) staining. Microtubule probes are visualized in red (where available). -
Gene Info — HNF1B
Entrez GeneID
6928Protein Accession#
P35680Gene Name
HNF1B
Gene Alias
FJHN, HNF1beta, HNF2, HPC11, LF-B3, LFB3, MODY5, TCF2, VHNF1
Gene Description
HNF1 homeobox B
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the homeodomain-containing superfamily of transcription factors. The protein binds to DNA as either a homodimer, or a heterodimer with the related protein hepatocyte nuclear factor 1-alpha. The gene has been shown to function in nephron development, and regulates development of the embryonic pancreas. Mutations in this gene result in renal cysts and diabetes syndrome and noninsulin-dependent diabetes mellitus, and expression of this gene is altered in some types of cancer. Multiple transcript variants encoding different isoforms have been found for this gene
Other Designations
transcription factor 2|transcription factor 2, hepatic|transcription factor 2, hepatic; LF-B3; variant hepatic nuclear factor
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
HNF1B expression regulates ECI2 gene expression, potentially serving a role in prostate cancer progression.
Dan C, Zhang H, Zeng W, Huang L, Gong X, Li H, Yang E, Wang L, Yao Q.
Oncology Letters 2019 Jan; 17(1):1094.
Application:IHC, WB, Human, Prostate gland tissue.
-
Investigation of HNF-1B as a diagnostic biomarker for pancreatic ductal adenocarcinoma.
Yang MX, Coates RF, Ambaye A, Gardner JA, Zubarick R, Gao Y, Skelly J, Liu JG, Mino-Kenudson M.
Biomarker Research 2018 Jul; 6:25.
Application:IHC-P, Human, Pancreatic ductal adenocarcinoma.
-
HNF1B expression regulates ECI2 gene expression, potentially serving a role in prostate cancer progression.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com