PPP1R8 monoclonal antibody (M21), clone 1G11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant PPP1R8.
Immunogen
PPP1R8 (AAH13360, 1 a.a. ~ 209 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGGEDDELKGLLGLPEEETELDNLTEFNTAHNKRISTLTIEEGNLDIQRPKRMRKNSRVTFSEDDEIINPEDVDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLI
Host
Mouse
Reactivity
Human, Mouse, Rat
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (48.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PPP1R8 monoclonal antibody (M21), clone 1G11. Western Blot analysis of PPP1R8 expression in Hela S3 NE(Cat # L013V3 ).Western Blot (Cell lysate)
PPP1R8 monoclonal antibody (M21), clone 1G11. Western Blot analysis of PPP1R8 expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
PPP1R8 monoclonal antibody (M21), clone 1G11. Western Blot analysis of PPP1R8 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
PPP1R8 monoclonal antibody (M21), clone 1G11. Western Blot analysis of PPP1R8 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PPP1R8 is 0.1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to PPP1R8 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — PPP1R8
Entrez GeneID
5511GeneBank Accession#
BC013360Protein Accession#
AAH13360Gene Name
PPP1R8
Gene Alias
ARD-1, ARD1, NIPP-1, NIPP1, PRO2047
Gene Description
protein phosphatase 1, regulatory (inhibitor) subunit 8
Omim ID
602636Gene Ontology
HyperlinkGene Summary
This gene, through alternative splicing, encodes three different isoforms. Two of the protein isoforms encoded by this gene are specific inhibitors of type 1 serine/threonine protein phosphatases and can bind but not cleave RNA. The third protein isoform lacks the phosphatase inhibitory function but is a single-strand endoribonuclease comparable to RNase E of E. coli. This isoform requires magnesium for its function and cleaves specific sites in A+U-rich regions of RNA. [provided by RefSeq
Other Designations
OTTHUMP00000003847|OTTHUMP00000003848|OTTHUMP00000003849|OTTHUMP00000044938|RNase E|activator of RNA decay|nuclear inhibitor of protein phosphatase-1|nuclear subunit of PP-1|protein phosphatase 1 regulatory inhibitor subunit 8|protein phosphatase 1 regula
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com