PML monoclonal antibody (M02), clone 1D12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PML.
Immunogen
PML (AAH00080, 411 a.a. ~ 510 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RDPIDVDLDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVV
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (60)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PML monoclonal antibody (M02), clone 1D12 Western Blot analysis of PML expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
PML monoclonal antibody (M02), clone 1D12. Western Blot analysis of PML expression in PC-12(Cat # L012V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PML is approximately 0.3ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between TP53 and PML. HeLa cells were stained with anti-TP53 rabbit purified polyclonal 1:1200 and anti-PML mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).Immunofluorescence
Immunofluorescence of monoclonal antibody to PML on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — PML
Entrez GeneID
5371GeneBank Accession#
BC000080Protein Accession#
AAH00080Gene Name
PML
Gene Alias
MYL, PP8675, RNF71, TRIM19
Gene Description
promyelocytic leukemia
Omim ID
102578Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Extensive alternative splicing of this gene results in several variations of the protein's central and C-terminal regions; all variants encode the same N-terminus. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
promyelocytic leukemia protein|promyelocytic leukemia, inducer of|tripartite motif protein TRIM19
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Senescence is a developmental mechanism that contributes to embryonic growth and patterning.
Mekayla Storer, Alba Mas, Alexandre Robert-Moreno, Matteo Pecoraro, M Carmen Ortells, Valeria Di Giacomo, Reut Yosef, Noam Pilpel, Valery Krizhanovsky, James Sharpe, William M Keyes.
Cell 2013 Nov; 155(5):1119.
Application:IF, Mouse, Mouse limb, Mouse neural tube.
-
Senescence is a developmental mechanism that contributes to embryonic growth and patterning.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com