CRYZ MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human CRYZ protein.
Immunogen
CRYZ (NP_001880.2, 1 a.a. ~ 329 a.a) full-length human protein.
Sequence
MATGQKLMRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIEAVGDNASAFKKGDRVFTSSTISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTAYRALIHSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGEKGIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSRGTIEINPRDTMAKESSIIGVTLFSSTKEEFQQYAAALQAGMEIGWLKPVIGSQYPLEKVAEAHENIIHGSGATGKMILLL
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (81); Rat (81)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CRYZ expression in transfected 293T cell line (H00001429-T01) by CRYZ MaxPab polyclonal antibody.
Lane 1: CRYZ transfected lysate(35.20 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of CRYZ transfected lysate using anti-CRYZ MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with CRYZ purified MaxPab mouse polyclonal antibody (B01P) (H00001429-B01P). -
Gene Info — CRYZ
Entrez GeneID
1429GeneBank Accession#
NM_001889.2Protein Accession#
NP_001880.2Gene Name
CRYZ
Gene Alias
DKFZp779E0834, FLJ41475
Gene Description
crystallin, zeta (quinone reductase)
Omim ID
123691Gene Ontology
HyperlinkGene Summary
Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. The former class is also called phylogenetically-restricted crystallins. This gene encodes a taxon-specific crystallin protein which has NADPH-dependent quinone reductase activity distinct from other known quinone reductases. It lacks alcohol dehydrogenase activity although by similarity it is considered a member of the zinc-containing alcohol dehydrogenase family. Unlike other mammalian species, in humans, lens expression is low. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. One pseudogene is known to exist. [provided by RefSeq
Other Designations
NADPH:quinone reductase|OTTHUMP00000011194|crystallin, zeta|quinone oxidoreductase
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com