Product Browser

Last updated: 2014/7/7

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BDNF (Human) Recombinant ProteinBioActive

  • Catalog # : P4375
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human BDNF (P23560) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 27
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • The activity is determined by the dose-dependent induction of C6 cell proliferation. The expected ED50 for this effect is 1.3-2 ug/mL.
  • Quality Control Testing:
  • 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue

    QC Testing of P4375
    Lane 1: non-reducing conditions
    Lane 2: reducing conditions
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 627
  • Gene Name:
  • BDNF
  • Gene Alias:
  • MGC34632
  • Gene Description:
  • brain-derived neurotrophic factor
  • Gene Summary:
  • The protein encoded by this gene is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression of this gene is reduced in both Alzheimer's and Huntington disease patients. This gene may play a role in the regulation of stress response and in the biology of mood disorders. Multiple transcript variants encoding distinct isoforms have been described for this gene. [provided by RefSeq
  • Other Designations:
  • neurotrophin
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook