MYC monoclonal antibody (M02), clone 1G7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of MYC expression in transfected 293T cell line by MYC monoclonal antibody (M02), clone 1G7.
Lane 1: MYC transfected lysate(49.561 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MYC on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MYC is 0.3 ng/ml as a capture antibody.
Immunofluorescence (Circulating Tumor Cell)
HeLa cells were stained with MYC-FITC labeled monoclonal antibody (Green). The cell nucleus were counterstained with DAPI (Blue).
Immunofluorescence
Immunofluorescence of monoclonal antibody to MYC on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (37.84 KDa) .
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant MYC.
Immunogen
MYC (NP_002458, 330 a.a. ~ 439 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (94)
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of MYC expression in transfected 293T cell line by MYC monoclonal antibody (M02), clone 1G7.
Lane 1: MYC transfected lysate(49.561 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MYC on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MYC is 0.3 ng/ml as a capture antibody.ELISA
Immunofluorescence (Circulating Tumor Cell)
HeLa cells were stained with MYC-FITC labeled monoclonal antibody (Green). The cell nucleus were counterstained with DAPI (Blue).Immunofluorescence
Immunofluorescence of monoclonal antibody to MYC on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — MYC
Entrez GeneID
4609GeneBank Accession#
NM_002467Protein Accession#
NP_002458Gene Name
MYC
Gene Alias
bHLHe39, c-Myc
Gene Description
v-myc myelocytomatosis viral oncogene homolog (avian)
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma. There is evidence to show that alternative translation initiations from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site result in the production of two isoforms with distinct N-termini. The synthesis of non-AUG initiated protein is suppressed in Burkitt's lymphomas, suggesting its importance in the normal function of this gene. [provided by RefSeq
Other Designations
avian myelocytomatosis viral oncogene homolog|myc proto-oncogene protein|v-myc avian myelocytomatosis viral oncogene homolog
-
Interactomes
-
Pathways
-
Diseases
-
Publication Reference
-
From midbody protein-protein interaction network construction to novel regulators in cytokinesis.
Chen TC, Lee SA, Hong TM, Shih JY, Lai JM, Chiou HY, Yang SC, Chan CH, Kao CY, Yang PC, Huang CY.
Journal of Proteome Research 2009 Nov; 8(11):4943.
Application：IF, Human, CL1-0, HeLa cells.
-
From midbody protein-protein interaction network construction to novel regulators in cytokinesis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com