Product Browser

Last updated: 2022/5/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CRBN polyclonal antibody 

  • Catalog # : PAB31825
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit monoclonal antibody raised against recombinant human CRBN.
  • Sequence:
  • EVEDQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVLPQVMMILIPGQTLPLQLFHPQEVSMVRNLIQKDRTFAVLAYSNVQERE
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse, Rat
  • Specificity:
  • This antibody reacts to CRBN.
  • Form:
  • Liquid
  • Purification:
  • Affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (0.25-2 ug/mL)
    Immunohistochemistry (1:200 - 1:500)
    Western Blot (0.04-0.4 ug/mL)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western blot analysis of mouse cell lines NIH-3T3 and rat cell line NBT-II.
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western blot analysis of HEK293 cells transfected with control siRNA, target specific siRNA probe # 1, using CRBN polyclonal antibody (Cat # PAB31825). Loading control: Anti-GAPDH.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human testis shows strong positivity in cells in seminiferous ducts.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human skeletal muscle shows only weak cytoplasmic positivity in striated muscle fibers.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human cerebral cortex shows strong positivity in neuropil.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human colon shows moderate cytoplasmic and nuclear positivity in peripheral ganglion.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • CRBN
  • Gene Alias:
  • DKFZp781K0715,MGC27358,MRT2A
  • Gene Description:
  • cereblon
  • Other Designations:
  • mental retardation, non-syndromic, autosomal recessive, 2A,protein x 0001
  • RSS
  • YouTube
  • Linkedin
  • Facebook