CETN3 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of RT-4 cell lysate with CETN3 polyclonal antibody (Cat # PAB31573).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with CETN3 polyclonal antibody (Cat # PAB31573) shows cytoplasmic and nucleolar positivity in cells in seminiferous ducts.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human CETN3.
Immunogen
Recombinant protein corresponding to human CETN3.
Sequence
AMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILK
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of RT-4 cell lysate with CETN3 polyclonal antibody (Cat # PAB31573).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with CETN3 polyclonal antibody (Cat # PAB31573) shows cytoplasmic and nucleolar positivity in cells in seminiferous ducts. -
Gene Info — CETN3
Entrez GeneID
1070Protein Accession#
O15182Gene Name
CETN3
Gene Alias
CEN3, MGC12502, MGC138245
Gene Description
centrin, EF-hand protein, 3 (CDC31 homolog, yeast)
Omim ID
602907Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene contains four EF-hand calcium binding domains, and is a member of the centrin protein family. Centrins are evolutionarily conserved proteins similar to the CDC31 protein of S. cerevisiae. Yeast CDC31 is located at the centrosome of interphase and mitotic cells, where it plays a fundamental role in centrosome duplication and separation. Multiple forms of the proteins similar to the yeast centrin have been identified in human and other mammalian cells, some of which have been shown to be associated with centrosome fractions. This protein appears to be one of the most abundant centrins associated with centrosome, which suggests a similar function to its yeast counterpart. [provided by RefSeq
Other Designations
CDC31 yeast homolog|EF-hand superfamily member|centrin 3
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com