PAGE4 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human placenta with PAGE4 polyclonal antibody (Cat # PAB31542) shows strong cytoplasmic and nuclear positivity in a subset of trophoblastic cells.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human PAGE4.
Immunogen
Recombinant protein corresponding to human PAGE4.
Sequence
DSSSSVHDLLVAAMSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQP
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human placenta with PAGE4 polyclonal antibody (Cat # PAB31542) shows strong cytoplasmic and nuclear positivity in a subset of trophoblastic cells. -
Gene Info — PAGE4
Entrez GeneID
9506Protein Accession#
O60829Gene Name
PAGE4
Gene Alias
FLJ35184, GAGE-9, GAGEC1, JM-27, JM27, PAGE-1, PAGE-4
Gene Description
P antigen family, member 4 (prostate associated)
Omim ID
300287Gene Ontology
HyperlinkGene Summary
This gene is a member of the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in prostate and prostate cancer, but is also expressed in other male and female reproductive tissues including testis, fallopian tube, uterus, and placenta, as well as in testicular cancer and uterine cancer. The protein encoded by this gene shares sequence similarity with other GAGE/PAGE proteins, and also belongs to a family of CT (cancer-testis) antigens. [provided by RefSeq
Other Designations
G antigen, family C, 1|OTTHUMP00000025849|OTTHUMP00000025850|prostate-associated gene protein 4
-
Interactome
-
Publication Reference
-
Evaluation of protein biomarkers of prostate cancer aggressiveness.
Rizzardi AE, Rosener NK, Koopmeiners JS, Isaksson Vogel R, Metzger GJ, Forster CL, Marston LO, Tiffany JR, McCarthy JB, Turley EA, Warlick CA, Henriksen JC, Schmechel SC.
BMC Cancer 2014 Apr; 14:244.
Application：IHC-P, Human, Human prostate cancer, Human tissue microarray.
-
Evaluation of protein biomarkers of prostate cancer aggressiveness.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com