PAGE4 monoclonal antibody (M01), clone 7C3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant PAGE4.
Immunogen
PAGE4 (NP_008934.1, 1 a.a. ~ 102 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQP
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.6 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PAGE4 expression in transfected 293T cell line by PAGE4 monoclonal antibody (M01), clone 7C3.
Lane 1: PAGE4 transfected lysate(11.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PAGE4 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — PAGE4
Entrez GeneID
9506GeneBank Accession#
NM_007003.2Protein Accession#
NP_008934.1Gene Name
PAGE4
Gene Alias
FLJ35184, GAGE-9, GAGEC1, JM-27, JM27, PAGE-1, PAGE-4
Gene Description
P antigen family, member 4 (prostate associated)
Omim ID
300287Gene Ontology
HyperlinkGene Summary
This gene is a member of the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in prostate and prostate cancer, but is also expressed in other male and female reproductive tissues including testis, fallopian tube, uterus, and placenta, as well as in testicular cancer and uterine cancer. The protein encoded by this gene shares sequence similarity with other GAGE/PAGE proteins, and also belongs to a family of CT (cancer-testis) antigens. [provided by RefSeq
Other Designations
G antigen, family C, 1|OTTHUMP00000025849|OTTHUMP00000025850|prostate-associated gene protein 4
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com