TNC polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human TNC.
Immunogen
Recombinant protein corresponding to amino acids 1765-1898 of human TNC.
Sequence
RLVKLIPGVEYLVSIIAMKGFEESEPVSGSFTTALDGPSGLVTANITDSEALARWQPAIATVDSYVISYTGEKVPEITRTVSGNTVEYALTDLEPATEYTLRIFAEKGPQKSSTITAKFTTDLDSPRDLTATEV
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human hippocampus shows distinct positivity in neuropil. -
Gene Info — TNC
Entrez GeneID
3371Protein Accession#
P24821Gene Name
TNC
Gene Alias
HXB, MGC167029, TN
Gene Description
tenascin C
Omim ID
187380Gene Ontology
HyperlinkGene Summary
cytotactin)|hexabrachion (tenascin)|tenascin C (hexabrachion)
Other Designations
OTTHUMP00000022738|hexabrachion (tenascin C, cytotactin)|hexabrachion (tenascin)|tenascin C (hexabrachion)
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
The co-expression of MMP-9 and Tenascin-C is significantly associated with the progression and prognosis of pancreatic cancer.
Xu Y, Li Z, Jiang P, Wu G, Chen K, Zhang X, Li X.
Diagnostic Pathology 2015 Dec; 10:211.
Application:IHC-P, Human, Human pancreatic cancer specimens.
-
Extracellular Hsp90 mediates an NF-κB dependent inflammatory stromal program: implications for the prostate tumor microenvironment.
Bohonowych JE, Hance MW, Nolan KD, Defee M, Parsons CH, Isaacs JS.
The Prostate 2014 Apr; 74(4):395.
-
CD99 is a novel prognostic stromal marker in non-small cell lung cancer.
Edlund K, Lindskog C, Saito A, Berglund A, Ponten F, Göransson-Kultima H, Isaksson A, Jirström K, Planck M, Johansson L, Lambe M, Holmberg L, Nyberg F, Ekman S, Bergqvist M, Landelius P, Lamberg K, Botling J, Ostman A, Micke P.
International Journal of Cancer 2012 Nov; 131(10):2264.
Application:IHC-P, Human, Human non-small cell lung cancer, Human tissue microarray.
-
Dissecting the oncogenic and tumorigenic potential of differentiated human induced pluripotent stem cells and human embryonic stem cells.
Ghosh Z, Huang M, Hu S, Wilson KD, Dey D, Wu JC.
Cancer Research 2011 Jul; 71(14):5030.
Application:WB-Ce, Human, Human embryonic stem cells, HUVECs.
-
Cardiomyopathy is associated with structural remodelling of heart valve extracellular matrix.
Schenke-Layland K, Stock UA, Nsair A, Xie J, Angelis E, Fonseca CG, Larbig R, Mahajan A, Shivkumar K, Fishbein MC, MacLellan WR.
European Heart Journal 2009 Sep; 30(18):2254.
Application:IF, IHC-P, Human, Pig, Human heart valve tissues, Pig aortic valve tissues.
-
The co-expression of MMP-9 and Tenascin-C is significantly associated with the progression and prognosis of pancreatic cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com